PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 301aa    MW: 33844.7 Da    PI: 5.0896
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023487.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.7e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  +   G  +W+++++  g++R++k+c++rw +yl
      Pbr023487.1 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.21.4e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia +++ gRt++++k++w+++
      Pbr023487.1  70 LTEAEEQLVIDLHARLGNR-WSKIAGRLP-GRTDNEIKNHWNTH 111
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.923961IPR017930Myb domain
SuperFamilySSF466895.24E-2711108IPR009057Homeodomain-like
SMARTSM007171.5E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001671.74E-81661No hitNo description
PROSITE profilePS5129427.29562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2464116IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1469111IPR001005SANT/Myb domain
CDDcd001677.53E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TEAEEQLVID LHARLGNRWS KIAGRLPGRT DNEIKNHWNT HIKKKLLRMG  120
IDPVTHEPLH KEELPSNIKE NNSSSSSHDH SDHENNLPAD KSINGLHNSQ ENDQSMVNSS  180
GSEDINSSTE NSSTGAESVL LDSICNDNLL MNTLWMDETP LIDALWNDNN QVELDRGGIN  240
YSITENNGMG FQSNWDDNWT WLLDCQDFGI HDFGMDCFSN VEVNGINTLE VGEKLSTTIN  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009354562.10.0PREDICTED: protein ODORANT1-like
RefseqXP_009354566.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-104ODO1_PETHY; Protein ODORANT1
TrEMBLM5WYP61e-151M5WYP6_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s07830.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-100myb domain protein 85